US Indymedia Global Indymedia Publish About us
Printed from Boston IMC :
IVAW Winter Soldier

Winter Soldier
Brad Presente

Other Local News

Spare Change News
Open Media Boston
Somerville Voices
Cradle of Liberty
The Sword and Shield

Local Radio Shows

WMBR 88.1 FM
What's Left
WEDS at 8:00 pm
Local Edition
FRI (alt) at 5:30 pm

WMFO 91.5 FM
Socialist Alternative
SUN 11:00 am

WZBC 90.3 FM
Sounds of Dissent
SAT at 11:00 am
Truth and Justice Radio
SUN at 6:00 am

Create account Log in
War and Militarism
The War in Libya and the Crisis of U.S. Imperialism Explained - Video
Media File uhuru-omaliyeshitelaspeaksatphillysfreedomtheatreonworldwideb368-874.jpg
Artist/Provider Uhuru
  View associated article
See also
File Size 13k (image/jpeg)
Date Posted 09 Apr 2011
This work is in the public domain